PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 332aa    MW: 36702.8 Da    PI: 5.2353
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42999.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.8e-10143192554
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                 kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  KFK42999.1 143 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 192
                 9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-16139203IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909141204IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.9E-8143198No hitNo description
SuperFamilySSF579591.62E-10143194No hitNo description
PfamPF001703.2E-8143191IPR004827Basic-leucine zipper domain
CDDcd147031.15E-21144193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEKSDPPPSI TPSDPNPNPN PVPSSFHRRS RSDDMSMFMF MDPLISSSGA PPSSDDLPSD  60
DDLFSSFIDV DSLSSNPNLT FPNPSLCSNS VSGATPPPSS SRPRHRHSNS VDAGCAMYAG  120
EIMDAKKAMP PEKLSELWNI DPKRAKRILA NRQSAARSKE RKARYIQELE RKVQSLQTEA  180
TTLSAQLTLF QRDTNGLANE NTELKLRLQA MEQQAQLRNA LNEALRKEVE RMKMETGEMS  240
DHSDSFEMGM QQIQYSPSTF MAIPPYHGSM NGQDMQHQMH SSFNPMEMSN SQSVSEFLQN  300
GRLQGLEISS NSSSLVKSEG PSVSASESSS AY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417873.11e-177hypothetical protein EUTSA_v10008146mg
SwissprotQ6S4P44e-83RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A087HLJ70.0A0A087HLJ7_ARAAL; Uncharacterized protein
STRINGAl_scaffold_0001_6231e-164(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-141basic leucine-zipper 52